Transglutaminase 5 (TGM5) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TGM5 antibody: synthetic peptide directed towards the C terminal of human TGM5. Synthetic peptide located within the following region: VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	81 kDa
Gene Name	transglutaminase 5
Database Link	NP_963925 Entrez Gene 9333 Human UniProt ID O43548
Background	TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS).
Synonyms	PSS2; TGASE5; TGASEX; TGM6; TGMX; TGX
Note	Dog: 100%; Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Mouse: 86%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.