B3GALTL (B3GLCT) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-B3GALTL antibody: synthetic peptide directed towards the middle region of human B3GALTL. Synthetic peptide located within the following region: DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	beta 3-glucosyltransferase
Database Link	NP_919299 Entrez Gene 145173 Human UniProt ID Q6Y288
Background	B3GALTL is the O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. B3GALTL specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan.B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin (see THBS1; MIM 188060) type-1 repeats (TSRs) of many biologically important proteins. Biosynthesis of glucosyl-beta-1,3-fucose-O- is initiated by protein O-fucosyltransferase-2 (POFUT2; MIM 610249), which attaches the fucosyl residue to a serine or threonine within the TSR. B3GALTL subsequently transfers the glucose onto TSR-fucose (Hess et al., 2008 [PubMed 18199743]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-270 DN999521.1 41-310 271-457 AB101481.1 161-347 458-467 DN999521.1 499-508 468-1217 AB101481.1 358-1107 1218-1279 DA290408.1 515-576 1280-1607 AB101481.1 1170-1497 1608-2495 AY190526.1 1498-2385 2496-3459 AY190526.1 2387-3350 3460-4071 AV728071.1 87-698 4072-4221 AA769548.1 1-150 c
Synonyms	B3GALTL; B3Glc-T; B3GTL; beta3Glc-T; Gal-T
Note	Human: 100%; Dog: 93%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.