Pigw Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Pigw antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SIGYQEHSTEYGVHWNFFFTIIVVKLITSLLLIIFPLNKSWIVAISITVL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	phosphatidylinositol glycan anchor biosynthesis, class W
Database Link	NP_919443 Entrez Gene 378774 Rat UniProt ID Q7TSN4
Background	Pigw is a probable acetyltransferase, which acetylates the inositol ring of phosphatidylinositol during biosynthesis of GPI-anchor. Acetylation during GPI-anchor biosynthesis is not essential for the subsequent mannosylation and is usually removed soon after the attachment of GPIs to proteins
Synonyms	FLJ37433; Gwt1; PIG-W
Note	Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Yeast: 91%; Mouse: 86%; Bovine: 86%; Zebrafish: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.