DNMT3B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DNMT3B antibody: synthetic peptide directed towards the middle region of human DNMT3B. Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	86 kDa
Gene Name	DNA (cytosine-5-)-methyltransferase 3 beta
Database Link	NP_787045 Entrez Gene 13436 MouseEntrez Gene 1789 Human UniProt ID Q9UBC3
Background	DNMT3B is required for genome wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. DNMT3B may preferentially methylate nucleosomal DNA within the nucleosome core region. DNMT3B may function as transcriptional co-repressor by associating with CBX4 and independently of DNA methylation. DNMT3B seems to be involved in gene silencing. In association with DNMT1 and via the recruitment of CTCFL/BORIS, DNMT3B is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Six alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined.
Synonyms	ICF; ICF1; M.HsaIIIB
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency
Protein Pathways	Cysteine and methionine metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.