UGT3A1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-UGT3A1 antibody is: synthetic peptide directed towards the N-terminal region of Human UGT3A1. Synthetic peptide located within the following region: WFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	UDP glycosyltransferase family 3 member A1
Database Link	NP_689617 Entrez Gene 133688 Human UniProt ID Q6NUS8
Background	The function of this protein remains unknown.
Synonyms	FLJ26528; FLJ34658
Note	Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.