Il36rn Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Il1f5 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	interleukin 36 receptor antagonist
Database Link	NP_001101284 Entrez Gene 311783 Rat
Background	The function of Il1f5 remains unknown.
Synonyms	Il1f5
Note	Dog: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Rabbit: 92%; Pig: 77%; Guinea pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.