APBB2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-APBB2 antibody: synthetic peptide directed towards the middle region of human APBB2. Synthetic peptide located within the following region: QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	81 kDa
Gene Name	amyloid beta precursor protein binding family B member 2
Database Link	NP_775098 Entrez Gene 323 Human UniProt ID Q92870
Background	APBB2 may modulate the internalization of beta-amyloid precursor protein.The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction.
Synonyms	FE65L; FE65L1
Note	Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.