ZNF539 (ZNF254) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF254 antibody is: synthetic peptide directed towards the middle region of Human ZNF254. Synthetic peptide located within the following region: WSSTLTNHRKIYTEEKPYKCEEYNKSPKQLSTLTTHEIIHAGEKLYKCEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	zinc finger protein 254
Database Link	NP_975011 Entrez Gene 9534 Human UniProt ID O75437
Background	ZNF254 is a Zinc Finver protein. Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins.
Synonyms	BMZF-5; HD-ZNF1; ZNF91L; ZNF539
Note	Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.