Dux4 (DUX4L1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DUX4 antibody is: synthetic peptide directed towards the middle region of Human DUX4. Synthetic peptide located within the following region: ACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSRQLRQHRRESRPW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	75 kDa
Gene Name	double homeobox 4 like 1
Database Link	NP_149418 Entrez Gene 22947 Human
Background	The function of this protein remains unknown.
Synonyms	DUX10
Note	Human: 100%; Dog: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.