TTC39C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TTC39C antibody is: synthetic peptide directed towards the middle region of Human TTC39C. Synthetic peptide located within the following region: NLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	tetratricopeptide repeat domain 39C
Database Link	NP_694943 Entrez Gene 125488 Human UniProt ID Q8N584
Background	The function of this protein remains unknown.
Synonyms	C18orf17; HsT2697
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.