CCNJL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CCNJL antibody is: synthetic peptide directed towards the C-terminal region of Human CCNJL. Synthetic peptide located within the following region: GQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	cyclin J like
Database Link	NP_078841 Entrez Gene 79616 Human UniProt ID Q8IV13
Background	The function of this protein remains unknown.
Synonyms	FLJ14166
Note	Human: 100%; Horse: 86%; Rat: 79%; Mouse: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.