PYCR3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PYCRL antibody is: synthetic peptide directed towards the N-terminal region of Human PYCRL. Synthetic peptide located within the following region: LIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFAT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	pyrroline-5-carboxylate reductase-like
Database Link	NP_075566 Entrez Gene 65263 Human UniProt ID Q53H96
Background	The function of this protein remains unknown.
Synonyms	PYCR3
Note	Rat: 100%; Human: 100%; Dog: 93%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Mouse: 85%; Bovine: 79%
Reference Data
Protein Pathways	Arginine and proline metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.