MRPS26 Rabbit Polyclonal Antibody
CAT#: TA330717
Rabbit Polyclonal Anti-MRPS26 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MRPS26 antibody is: synthetic peptide directed towards the C-terminal region of Human MRPS26. Synthetic peptide located within the following region: RQALEQARKAEEVQAWAQRKEREVLQLQEEVKNFITRENLEARVEAALDS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 24 kDa |
Gene Name | mitochondrial ribosomal protein S26 |
Database Link | |
Background | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. This gene lies adjacent to and downstream of the gonadotropin-releasing hormone precursor gene. |
Synonyms | C20orf193; dJ534B8.3; GI008; MRP-S13; MRP-S26; MRPS13; NY-BR-87; RPMS13 |
Note | Human: 100%; Rabbit: 91%; Dog: 86%; Pig: 86%; Horse: 86%; Yeast: 83%; Bovine: 82%; Zebrafish: 82% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |