C11orf75 (SMCO4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C11orf75 antibody is: synthetic peptide directed towards the N-terminal region of Human C11orf75. Synthetic peptide located within the following region: KPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	6 kDa
Gene Name	single-pass membrane protein with coiled-coil domains 4
Database Link	NP_064564 Entrez Gene 56935 Human UniProt ID Q9NRQ5
Background	The function of this protein remains unknown.
Synonyms	C11orf75; FN5
Note	Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Yeast: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.