Tmem39a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tmem39a antibody is: synthetic peptide directed towards the middle region of Mouse Tmem39a. Synthetic peptide located within the following region: LGKWQKLEHGFYSNAPQHIWSENTIWPQGVLVRHSRCLYRAMGPYNVAVP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	transmembrane protein 39a
Database Link	NP_080683 Entrez Gene 67846 Mouse UniProt ID Q9CYC3
Background	The function of this protein remains unknown.
Synonyms	FLJ10902
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.