HOXB9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HOXB9 antibody: synthetic peptide directed towards the N terminal of human HOXB9. Synthetic peptide located within the following region: SPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	homeobox B9
Database Link	NP_076922 Entrez Gene 3219 Human UniProt ID P17482
Background	HOXB9 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. HOXB9 is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.
Synonyms	HOX-2.5; HOX2; HOX2E
Note	Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.