Ceramide synthase 2 (CERS2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LASS2 antibody: synthetic peptide directed towards the N terminal of human LASS2. Synthetic peptide located within the following region: EKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	ceramide synthase 2
Database Link	NP_071358 Entrez Gene 29956 Human UniProt ID Q96G23
Background	LASS2 is a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described.
Synonyms	L3; LASS2; SP260; TMSG1
Note	Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Horse: 92%; Bovine: 86%
Reference Data
Protein Families	Transcription Factors, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.