CRTR1 (TFCP2L1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TFCP2L1 antibody: synthetic peptide directed towards the middle region of human TFCP2L1. Synthetic peptide located within the following region: HGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	transcription factor CP2-like 1
Database Link	NP_055368 Entrez Gene 29842 Human UniProt ID Q9NZI6
Background	TFCP2L1 is a transcriptional suppressor. TFCP2L1 may suppress UBP1-mediated transcriptional activation. It modulates the placental expression of CYP11A1.
Synonyms	CRTR1; LBP-9; LBP9
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.