LONRF1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LONRF1 antibody: synthetic peptide directed towards the N terminal of human LONRF1. Synthetic peptide located within the following region: MSSPAVARTSPGGSREMAPAPQGRGRFWEVGGGSGHRLERAAAESERWEL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	LON peptidase N-terminal domain and ring finger 1
Database Link	NP_689484 Entrez Gene 91694 Human UniProt ID Q17RB8
Background	The function remains unknown.
Synonyms	RNF191
Note	Immunogen sequence homology: Human: 100%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families	Druggable Genome, Protease, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.