SYVN1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the C terminal of human SYVN1. Synthetic peptide located within the following region: ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	synoviolin 1
Database Link	NP_757385 Entrez Gene 84447 Human UniProt ID Q86TM6
Background	SYVN1 is a protein involved in endoplasmic reticulum (ER)-associated degradation. The protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins.This gene encodes a protein involved in endoplasmic reticulum (ER)-associated degradation. The encoded protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins. This gene and the mitochondrial ribosomal protein L49 gene use in their respective 3' UTRs some of the same genomic sequence. Sequence analysis identified two transcript variants that encode different isoforms.
Synonyms	DER3; HRD1
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 92%; Bovine: 85%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Ubiquitin mediated proteolysis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.