TRIM45 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRIM45 antibody: synthetic peptide directed towards the N terminal of human TRIM45. Synthetic peptide located within the following region: FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	tripartite motif containing 45
Database Link	NP_079464 Entrez Gene 80263 Human UniProt ID Q9H8W5
Background	TRIM45 is a member of the tripartite motif family. It may function as a transcriptional repressor of the mitogen-activated protein kinase pathway. Alternatively spliced transcript variants have been described. TRIM45 belongs to a family of tripartite motif (TRIM) proteins that play important roles in a variety of cellular functions, including cell proliferation, differentiation, development, oncogenesis, and apoptosis (Wang et al., 2004 [PubMed 15351693]). [supplied by OMIM]
Synonyms	RNF99
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.