Unkl Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Unkl antibody is: synthetic peptide directed towards the N-terminal region of Mouse Unkl. Synthetic peptide located within the following region: IASLDKDLEEQDLGLTGLNGVPGSIWDFVSGSFSPSPSPILNSGPSASSS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	unkempt family like zinc finger
Database Link	NP_083065 Entrez Gene 74154 Mouse UniProt ID Q5FWH2
Background	The function of this protein remains unknown.
Synonyms	C16orf28; FLJ12623; FLJ23360; KIAA0734; MGC5179; OTTHUMP00000197302; unkempt-like; ZC3H5L; ZC3HDC5L
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.