CCR8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CCR8 antibody: synthetic peptide directed towards the middle region of human CCR8. Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	C-C motif chemokine receptor 8
Database Link	NP_005192 Entrez Gene 1237 Human UniProt ID P51685
Background	CCR8 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. Its gene is located at the chemokine receptor gene cluster region.
Synonyms	CC-CKR-8; CCR-8; CDw198; CKRL1; CMKBR8; CMKBRL2; CY6; GPRCY6; TER1
Note	Immunogen sequence homology: Human: 100%; Bovine: 93%; Rabbit: 81%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane
Protein Pathways	Chemokine signaling pathway, Cytokine-cytokine receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.