KIF20A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KIF20A antibody: synthetic peptide directed towards the middle region of human KIF20A. Synthetic peptide located within the following region: KRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	100 kDa
Gene Name	kinesin family member 20A
Database Link	NP_005724 Entrez Gene 10112 Human UniProt ID O95235
Background	KIF20A interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B.It may act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. KIF20A has a microtubule plus end-directed motility.
Synonyms	MKLP2; RAB6KIFL
Note	Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Chicken: 92%; Rat: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.