KIF20A Rabbit Polyclonal Antibody

CAT#: TA330414

Rabbit Polyclonal Anti-KIF20A Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of kinesin family member 20A (KIF20A)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human kinesin family member 20A (KIF20A), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human kinesin family member 20A (KIF20A), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-KIF20A antibody: synthetic peptide directed towards the middle region of human KIF20A. Synthetic peptide located within the following region: KRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 100 kDa
Gene Name kinesin family member 20A
Background KIF20A interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B.It may act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. KIF20A has a microtubule plus end-directed motility.
Synonyms MKLP2; RAB6KIFL
Note Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Chicken: 92%; Rat: 86%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...