GPR18 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GPR18 antibody: synthetic peptide directed towards the middle region of human GPR18. Synthetic peptide located within the following region: GVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	G protein-coupled receptor 18
Database Link	NP_005283 Entrez Gene 2841 Human UniProt ID Q14330
Background	GPR18 is receptor for N-arachidonyl glycine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. It may contribute to regulation of the immune system. N-arachidonylglycine is a natural ligand for GPR18.
Synonyms	G protein-coupled receptor 18; OTTHUMP00000018613
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.