Cullin 2 (CUL2) Rabbit Polyclonal Antibody

CAT#: TA330364

Rabbit Polyclonal Anti-CUL2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of cullin 2 (CUL2)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human cullin 2 (CUL2), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human cullin 2 (CUL2), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CUL2 antibody: synthetic peptide directed towards the middle region of human CUL2. Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 87 kDa
Gene Name cullin 2
Background CUL2 is a core component of multiple cullin-RING-based ECS (ElonginB/C-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of target proteins. This protein may serve as a rigid scaffold in the complex and may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1 By similarity. The functional specificity of the ECS complex depends on the substrate recognition component. ECS(VHL) mediates the ubiquitination of hypoxia-inducible factor (HIF).
Synonyms MGC131970
Note Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Reference Data
Protein Families Druggable Genome
Protein Pathways Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...