TIAL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TIAL1 antibody: synthetic peptide directed towards the C terminal of human TIAL1. Synthetic peptide located within the following region: WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	TIA1 cytotoxic granule-associated RNA binding protein-like 1
Database Link	NP_003243 Entrez Gene 7073 Human UniProt ID Q01085
Background	The protein encoded by TIAL1 is a member of a family of RNA-binding proteins and possesses nucleolytic activity against cytotoxic lymphocyte target cells. The gene product is a cytotoxic granule-associated protein and has been shown to bind specifically to poly(A) homopolymers and to fragment DNA in permeabilized target cells. It has been suggested that members of this protein family may be involved in the induction of apoptosis. One isoform contains a lysosome-targeting motif in its C-terminal auxiliary domain; however, alternative splicing results in a T-cluster DNA-binding isoform, differing at the C-terminus where a hydrophobic sequence replaces the lysosome-targeting motif.
Synonyms	TCBP; TIAR
Note	Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Mouse: 85%; Rat: 85%; Zebrafish: 76%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.