SEPTIN4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SEPT4: synthetic peptide directed towards the N terminal of human SEPT4 (septin-4). Synthetic peptide located within the following region: RSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	septin 4
Database Link	NP_004565 Entrez Gene 5414 Human UniProt ID Q8NEP4
Background	The SEPT4 gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. SEPT4 encodes a protein that is thought to be part of a complex involved in cytokinesis.
Synonyms	ARTS; BRADEION; CE5B3; H5; hCDCREL-2; hucep-7; MART; PNUTL2; SEP4
Note	Immunogen sequence homology: Crab-eating macaque:100%; Sumatran orangutan:100%; Human:100%; Dog:84%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.