DC2L1 (DYNC2LI1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DYNC2LI1 antibody is: synthetic peptide directed towards the N-terminal region of Human DYNC2LI1. Synthetic peptide located within the following region: LDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	dynein cytoplasmic 2 light intermediate chain 1
Database Link	NP_056337 Entrez Gene 51626 Human UniProt ID Q8TCX1
Background	DYNC2LI1 may function as a motor for intraflagellar retrograde transport and functions in cilia biogenesis.
Synonyms	CGI-60; D2LIC; LIC3; SRTD15
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.