TRF4 2 (PAPD5) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PAPD5 antibody is: synthetic peptide directed towards the C-terminal region of Human PAPD5. Synthetic peptide located within the following region: SSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	PAP associated domain containing 5
Database Link	NP_071892 Entrez Gene 64282 Human UniProt ID Q8NDF8
Background	PAPD5 plays a role in replication-dependent histone mRNA degradation.It may be involved in the terminal uridylation of mature histone mRNAs before their degradation is initiated. DNA polymerase, probably involved in DNA repair. It may play a role in sister chromatid cohesion.
Synonyms	FLJ40270; PAP associated domain containing 5; topoisomerase-related function protein 4-2; TRF4-2
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.