PSMD6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6. Synthetic peptide located within the following region: YEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	proteasome 26S subunit, non-ATPase 6
Database Link	NP_055629 Entrez Gene 9861 Human UniProt ID Q15008
Background	PSMD6 acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
Synonyms	p42A; p44S10; Rpn7; S10; SGA-113M
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 86%
Reference Data
Protein Pathways	Proteasome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.