TLE4 Rabbit Polyclonal Antibody
CNY 5,250.00
Cited in 1 publication. |
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TLE4 antibody: synthetic peptide directed towards the N terminal of human TLE4. Synthetic peptide located within the following region: GAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 84 kDa |
Gene Name | transducin like enhancer of split 4 |
Database Link | |
Background | TLE4 is the transcriptional corepressor that binds to a number of transcription factors. It inhibits the transcriptional activation mediated by PAX5, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. |
Synonyms | BCE-1; BCE1; E(spI); ESG; ESG4; Grg-4; GRG4 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93% |
Reference Data | |
Protein Families | Transcription Factors |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Mapping the distribution of language related genes FoxP1, FoxP2 and CntnaP2 in the brains of vocal learning bat species
,Rodenas-Cuadrado, PM;Mengede, J;Baas, L;Devanna, P;Schmid, TA;Yartsev, M;Firzlaff, U;Vernes, SC;,
J. Comp. Neurol.
,PubMed ID 29297931
[TLE4]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |