EYA3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EYA3 antibody: synthetic peptide directed towards the middle region of human EYA3. Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	EYA transcriptional coactivator and phosphatase 3
Database Link	NP_001981 Entrez Gene 2140 Human UniProt ID Q99504
Background	Eyes absent homolog 3 (EYA3) is a member of the eyes absent (EYA) family of proteins. This protein may act as a transcriptional activator and have a role during development. A similar protein in mice can act as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene.
Synonyms	DKFZp686C132
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Sheep: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data
Protein Families	Phosphatase, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.