ZFHX2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF409 antibody: synthetic peptide directed towards the middle region of human ZNF409. Synthetic peptide located within the following region: GGQGSPPEASLPPSAGDKEPKTKSSWQCKVCSYETNISRNLRIHMTSEKH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	92 kDa
Gene Name	zinc finger homeobox 2
Database Link	NP_207646 Entrez Gene 85446 Human UniProt ID Q9C0A1
Background	ZNF209 is a candidate transcription factor
Synonyms	ZFH-5; ZNF409
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Bovine: 92%; Mouse: 87%; Rat: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.