Zfp384 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Znf384 antibody is: synthetic peptide directed towards the N-terminal region of RAT Znf384. Synthetic peptide located within the following region: EKGCGLAPPHYPTLLTVPASVSLSSGISMDTESKSEQLTPHSQASVTQNI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	zinc finger protein 384
Database Link	NP_596920 Entrez Gene 171018 Rat UniProt ID Q9EQJ4
Background	Znf384 activates transcription of matrix metalloproteinase genes; It plays a role in nucleocytoplasmic transport.
Synonyms	BB163993; C130073D16Rik; Ciz; Nmp4; NP; Znf384
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.