GCM1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GCM1 antibody: synthetic peptide directed towards the C terminal of human GCM1. Synthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	glial cells missing homolog 1
Database Link	NP_003634 Entrez Gene 8521 Human UniProt ID Q9NP62
Background	GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.
Synonyms	GCMA; hGCMa
Note	Immunogen sequence homology: Human: 100%; Horse: 92%; Dog: 90%; Rabbit: 81%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.