HOXA10 Rabbit Polyclonal Antibody
CAT#: TA330060
Rabbit Polyclonal Anti-HOXA10 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,537.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HOXA10 antibody: synthetic peptide directed towards the N terminal of human HOXA10. Synthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | homeobox A10 |
Database Link | |
Background | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA10 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. |
Synonyms | HOX1; HOX1.8; HOX1H; PL |
Note | Immunogen sequence homology: Human: 92%; Dog: 85%; Rabbit: 85%; Mouse: 78% |
Reference Data | |
Protein Families | Transcription Factors |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
HOXA7, HOXA9, and HOXA10 are differentially expressed in clival and sacral chordomas
,Jäger, D;Barth, TFE;Brüderlein, S;Scheuerle, A;Rinner, B;von Witzleben, A;Lechel, A;Meyer, P;Mayer-Steinacker, R;Baer, AV;Schultheiss, M;Wirtz, CR;Möller, P;Mellert, K;,
Sci Rep
,PubMed ID 28515451
[HOXA10]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |