MMP2 Rabbit Polyclonal Antibody
CNY 5,250.00
Cited in 3 publications. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 74 kDa |
Gene Name | matrix metallopeptidase 2 |
Database Link | |
Background | MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X. |
Synonyms | CLG4; CLG4A; MMP-2; MMP-II; MONA; TBE-1 |
Note | Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Rabbit: 93% |
Reference Data | |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Bladder cancer, GnRH signaling pathway, Leukocyte transendothelial migration, Pathways in cancer |
Citations (3)
The use of this Antibodies has been cited in the following citations: |
---|
Immunochemical and urodynamic outcomes after polypropylene mesh explant from the pelvic wall of rats.
,null,
International urogynecology journal
,PubMed ID 34037814
[MMP2]
|
Immunochemical analysis on polypropylene mesh: does mesh size make a difference?
,null,
International urogynecology journal
,PubMed ID 32651643
[MMP2]
|
Curcumol inhibits the viability and invasion of colorectal cancer cells via miR-30a-5p and Hippo signaling pathway
,null,
Oncology Letters
,PubMed ID 33732375
[MMP2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |