Syntaxin 1a (STX1A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-STX1A antibody: synthetic peptide directed towards the N terminal of human STX1A. Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	syntaxin 1A
Database Link	NP_004594 Entrez Gene 6804 Human UniProt ID Q16623
Background	Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor which produces explosive exocytosis. Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1253 BC064644.1 1-1253 1254-2117 BC000444.2 1209-2072
Synonyms	HPC-1; P35-1; STX1; SYN1A
Note	Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Reference Data
Protein Families	Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways	SNARE interactions in vesicular transport

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.