SNAP-beta (NAPB) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NAPB antibody: synthetic peptide directed towards the N terminal of human NAPB. Synthetic peptide located within the following region: MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAAN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	NSF attachment protein beta
Database Link	NP_071363 Entrez Gene 63908 Human UniProt ID Q9H115
Background	NAPB is required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
Synonyms	SNAP-BETA; SNAPB
Note	Immunogen sequence homology: Chicken: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.