Gatad2a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GATAD2A antibody: synthetic peptide directed towards the N terminal of mouse GATAD2A. Synthetic peptide located within the following region: MSEEACRTRSQKRTLEPDLTEDDVENKKMKMEKGSSELTVDGDSRVMPEP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	GATA zinc finger domain containing 2A
Database Link	NP_663571 Entrez Gene 234366 Mouse UniProt ID Q8CHY6
Background	GATAD2A's function is not determined.
Synonyms	FLJ20085; FLJ21017; Hp66alpha; OTTHUMP00000201911; p66alpha
Note	Immunogen sequence homology: Mouse: 100%; Rat: 92%; Human: 91%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.