Zkscan8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Zfp192 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SQKPTPSQKGSSGDQEVTARLLTAGFQTLERIEDMAVSLIREEWLLDPSQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	zinc finger with KRAB and SCAN domains 8
Database Link	NP_631880 Entrez Gene 93681 Mouse
Background	The function of this protein remains unknown.
Synonyms	LD5-1; ZNF192; ZSCAN40
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 93%; Dog: 86%; Human: 86%; Rabbit: 83%; Bovine: 79%; Horse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.