Tcf23 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TCF23 antibody: synthetic peptide directed towards the C terminal of mouse TCF23. Synthetic peptide located within the following region: PMRSRLYAGGLGCSDLDSTTAITTGQRCKDAELGSQDSVAAESLLTSPAF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	transcription factor 23
Database Link	NP_444315 Entrez Gene 69852 Mouse UniProt ID Q9JLR5
Background	TCF23 belongs to the basic helix-loop-helix (bHLH) family are involved in various cell differentiation processes
Synonyms	bHLHa24; OUT
Note	Immunogen sequence homology: Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.