Tsc22d4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tsc22d4 antibody: synthetic peptide directed towards the middle region of mouse Tsc22d4. Synthetic peptide located within the following region: VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	TSC22 domain family, member 4
Database Link	NP_076399 Entrez Gene 78829 Mouse UniProt ID Q9EQN3
Background	Tsc22d4 may be a transcriptional repressor.
Synonyms	THG-1; THG1; TILZ2; TSC-22-like
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 90%; Human: 90%; Bovine: 90%; Rabbit: 90%; Guinea pig: 90%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.