IRX4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IRX4 antibody: synthetic peptide directed towards the N terminal of human IRX4. Synthetic peptide located within the following region: SAAALGVYGGPYGGSQGYGNYVTYGSEASAFYSLNSFDSKDGSGSAHGGL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	iroquois homeobox 4
Database Link	NP_057442 Entrez Gene 50805 Human UniProt ID P78413
Background	IRX4 is likely to be an important mediator of ventricular differentiation during cardiac development.
Synonyms	IRXA3
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.