Phf7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Phf7 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Phf7. Synthetic peptide located within the following region: AIYHRKCIQKYAHTSAKHFFKCPQCNNREEFPQEMLRMGIHIPDRRWRLI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	PHD finger protein 7
Database Link	NP_082225 Entrez Gene 71838 Mouse UniProt ID Q9DAG9
Background	Phf7 may play a role in spermatogenesis.
Synonyms	DKFZp434L1850; HSPC045; HSPC226; MGC26088; NYD-SP6
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.