UBE3C Rabbit Polyclonal Antibody
CAT#: TA329844
Rabbit Polyclonal Anti-UBE3C Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-UBE3C antibody is: synthetic peptide directed towards the N-terminal region of Human UBE3C. Synthetic peptide located within the following region: MFSFEGDFKTRPKVSLGGASRKYSIQRSAFDRCATLSQSGGAFPIANGPN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 44 kDa |
Gene Name | ubiquitin protein ligase E3C |
Database Link | |
Background | E3 ubiquitin-protein ligase that accepts ubiquitin from the E2 ubiquitin-conjugating enzyme UBE2D1 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. UBE3C can assemble unanchored poly-ubiquitin chains in either 'Lys-29'- or 'Lys-48'-linked polyubiquitin chains. It has preference for 'Lys-48' linkages. It can target itself for ubiquitination in vitro and may promote its own degradation in vivo. |
Synonyms | HECTH2 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |