FBXL5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FBXL5 antibody: synthetic peptide directed towards the middle region of human FBXL5. Synthetic peptide located within the following region: VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	F-box and leucine-rich repeat protein 5
Database Link	NP_036293 Entrez Gene 26234 Human UniProt ID Q9UKA1
Background	FBXL5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL5 belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats. Alternative splicing of this gene generates 2 transcript variants.
Synonyms	FBL4; FBL5; FLR1
Note	Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 86%; Rabbit: 86%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.