BRAP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BRAP antibody: synthetic peptide directed towards the middle region of human BRAP. Synthetic peptide located within the following region: YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	BRCA1 associated protein
Database Link	NP_006759 Entrez Gene 8315 Human UniProt ID Q7Z569
Background	The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signal in the cytoplasm.
Synonyms	BRAP2; IMP; RNF52
Note	Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 93%; Rabbit: 93%; Zebrafish: 93%; Pig: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.