CRTR1 (TFCP2L1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TFCP2L1 antibody: synthetic peptide directed towards the N terminal of human TFCP2L1. Synthetic peptide located within the following region: LRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	transcription factor CP2-like 1
Database Link	NP_055368 Entrez Gene 29842 Human UniProt ID Q9NZI6
Background	TFCP2L1 is a candidate CP2 family member. It is expressed in a developmentally regulated fashion in vivo and acts as a direct repressor of transcription. CP2-related proteins comprise a family of DNA-binding transcription factors that are generally activators of transcription and expressed ubiquitously.
Synonyms	CRTR1; LBP-9; LBP9
Note	Immunogen sequence homology: Dog: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Yeast: 75%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.